PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_015264-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 295aa    MW: 32944.5 Da    PI: 7.5542
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_015264-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.27.9e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEde+lv  v+ +G  +W++ ++  g++R++k+c++rw +yl
    NNU_015264-RA 14 KGPWTPEEDEKLVLHVQTHGHSNWRALPKLAGLNRCGKSCRLRWENYL 61
                     79********************************************97 PP

2Myb_DNA-binding50.64.3e-1667110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg ++ eE+e +++++  lG++ W+ Ia++++ gRt++++k++w++
    NNU_015264-RA  67 RGEFSHEEEETILNLHFILGNK-WSVIAKHLP-GRTDNEIKNFWNT 110
                      899*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.7E-25564IPR009057Homeodomain-like
PROSITE profilePS5129415.543961IPR017930Myb domain
SuperFamilySSF466895.99E-3111108IPR009057Homeodomain-like
SMARTSM007179.5E-151363IPR001005SANT/Myb domain
PfamPF002492.3E-161461IPR001005SANT/Myb domain
CDDcd001672.59E-121661No hitNo description
PROSITE profilePS5129423.96362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.8E-2565117IPR009057Homeodomain-like
SMARTSM007172.2E-1566114IPR001005SANT/Myb domain
PfamPF002491.4E-1467110IPR001005SANT/Myb domain
CDDcd001676.80E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MGRSPRCDQS GLRKGPWTPE EDEKLVLHVQ THGHSNWRAL PKLAGLNRCG KSCRLRWENY  60
LKPDIKRGEF SHEEEETILN LHFILGNKWS VIAKHLPGRT DNEIKNFWNT RLKKKLIKMG  120
FDPITHQSRT RILSSLPQLI PVEAYQLARL ISCLPQLIES SISYNNENPV LSSSQSAGNP  180
ISISPNSIGI ATTQSVPADS IFRLFSHLPD LQLPYCNLQT PEITVTSQGE SSLHGYPGRV  240
SASSLPPLPP PVSEIMISNP SVDGCSYEGG SPSFCPDQLP LDDPFFHEVL SFKQM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-281211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010269279.10.0PREDICTED: transcription repressor MYB4-like
TrEMBLD7TYQ55e-93D7TYQ5_VITVI; Putative uncharacterized protein
STRINGVIT_07s0141g00100.t012e-92(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10280.15e-80myb domain protein 92